SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5NCU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5NCU5
Domain Number 1 Region: 153-300
Classification Level Classification E-value
Superfamily EF-hand 2.25e-52
Family Osteonectin 0.000000098
Further Details:      
 
Domain Number 2 Region: 94-149
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000152
Family Ovomucoid domain III-like 0.0000355
Further Details:      
 
Domain Number 3 Region: 69-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family Follistatin (FS) module N-terminal domain, FS-N 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5NCU5
Sequence length 302
Comment (tr|Q5NCU5|Q5NCU5_MOUSE) Sparc protein {ECO:0000313|EMBL:CAJ18514.1} OX=10090 OS=Mus musculus (Mouse). GN=Sparc OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MRAWIFFLLCLAGRALAAPQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEE
TVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDS
SCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYER
DEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQH
PIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDL
VI
Download sequence
Identical sequences P07214 Q5NCU5
ENSMUSP00000018737 ENSMUSP00000018737 ENSMUSP00000018737 10090.ENSMUSP00000018737 NP_033268.1.92730 XP_021068314.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]