SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5NRH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5NRH7
Domain Number 1 Region: 7-264
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.44e-54
Family Haloperoxidase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5NRH7
Sequence length 268
Comment (tr|Q5NRH7|Q5NRH7_ZYMMO) Alpha/beta hydrolase fold protein {ECO:0000313|EMBL:AAV88677.1} KW=Complete proteome; Reference proteome OX=264203 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4). GN=ZMO0053 OC=Sphingomonadaceae; Zymomonas.
Sequence
MAFFYHGRDRYYYFDIGTGEPVLFLHGLCNSGRAWAPQVADMVDQGYRVIIPDLLGHGAS
SLLDREFTPKDQAQAMMAFLEYLGLKSAIVVALSLGGTVALEIATNYPATVEKLVLAGSF
LTMATSDRQQMLNSWIETLRQENGGIACFESGWLGLAGQKFAKTASGIACYQAWQAQAAI
QDSQSLIQWCEGMKRYDIRPNLEKVTAASLILAGEKDSMSPIKESQEIASLIKSATFKVV
TGEGHVFNVSSASEFKNCLHDFLKRGRS
Download sequence
Identical sequences Q5NRH7
gi|56550949|ref|YP_161788.1| WP_011240032.1.33991 WP_011240032.1.34904 WP_011240032.1.4952 264203.ZMO0053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]