SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5QG21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5QG21
Domain Number 1 Region: 626-746
Classification Level Classification E-value
Superfamily CheY-like 1.22e-24
Family Receiver domain of the ethylene receptor 0.025
Further Details:      
 
Domain Number 2 Region: 353-429
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000667
Family Homodimeric domain of signal transducing histidine kinase 0.0088
Further Details:      
 
Domain Number 3 Region: 185-335
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000154
Family GAF domain 0.0096
Further Details:      
 
Domain Number 4 Region: 435-503
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000246
Family Histidine kinase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5QG21
Sequence length 754
Comment (tr|Q5QG21|Q5QG21_SOLLC) Ethylene receptor {ECO:0000256|PIRNR:PIRNR026389} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=543834 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MMKKVVSWLLFLSIVASLWVVDGYIECPCDDSDAFFSMETMLFVQKAGDLGIAVAYFSIP
IEIIYFVSCSSFPFKWVLFQFGAFIVLCGLTHFLTFLTHFGKYTFHLILALIVCKLLTAL
VSMLTAITLMNLIPLLLKAKAREFMLRRKNRELDREVEKIKQLEELGLHVRMLTNEIRKS
IDRHTILYTTLVGLSKLLSLQNCVIWMPNENRTEMKLTHDTTRENVSSVYNVPIPISDRE
VKEIKGSDDVKILGADSRLAAASSRGSCEPESVAAIRIPMLTVSNFRGETREIVSQCYAI
LVLVQPCGHGRFWLNQEVEIVRAAADQVAVALSHAAVVEESEYIKDRLMEQNQALQKARE
EALRASQARSSFQTVMSHRLRRPMHSILGLLSMLQEQKLRDEQQLLVHSIIKSSNVVSTL
MDDVIVTSTKENVKFPLEMKHFQLHSLIREAACTAKSLCMYKGYNITIEVEKSFPNKVMG
DERRFFQVLLHIIGNLLNGIHGGHLTFKVLSASENDVSWKTPRSNSSNDIVYIKFEICTK
FNRSQSEITPAPPTYDTEEIEESLSFAVCRKLVHLMQGDIFIIRNLADFDQGMAVIVGFQ
RQPLIPLGMSEYVESSNPTYPHPVLRGVEVLLADYDDSNRAVTKKMLEKLGCIVTLVSSG
YECLGAVGPVVSSLQIILLDLHLPDLDGFEVTMRLRKHRRQTWPLIIGLAAITDEDIRKC
LKIGMNGIICKPLLLSGLADELQKVLLHANRGMP
Download sequence
Identical sequences Q5QG21
NP_001234150.2.44838 Solyc09g089610.2.1 Solyc09g089610.2.1 Sopim09g089610.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]