SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5QJV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5QJV7
Domain Number 1 Region: 129-155,183-420
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.44e-69
Family Nuclear receptor ligand-binding domain 0.00000000199
Further Details:      
 
Domain Number 2 Region: 76-161
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-30
Family Nuclear receptor 0.00000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5QJV7
Sequence length 422
Comment (sp|Q5QJV7|ERR1_RAT) Nuclear receptor subfamily 3 group B member 1 KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Esrra; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVTLASGPAPARCLPGHKEEEDGEGAG
SGEQGSGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAPVNALVSHLLVVEPEKLYAMPDPASPDGHLPAVATLCDLFDREIVVTIS
WAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAG
LGDLGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLE
YEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAM
MD
Download sequence
Identical sequences O08580 Q5QJV7
ENSRNOP00000028697 ENSMUSP00000025906 NP_001008511.2.100692 NP_001008511.2.4139 NP_031979.2.92730 ENSRNOP00000028697 10116.ENSRNOP00000028697 ENSMUSP00000025906 ENSMUSP00000025906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]