SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5QLQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5QLQ9
Domain Number 1 Region: 32-117
Classification Level Classification E-value
Superfamily HMG-box 1.96e-22
Family HMG-box 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5QLQ9
Sequence length 133
Comment (tr|Q5QLQ9|Q5QLQ9_ORYSJ) cDNA clone:002-115-A10, full insert sequence {ECO:0000313|EMBL:BAG89148.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSJNBb0063G05.4 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MKTRSQTAPKPLKTVRLPPVKPRPKPPPPQPQPPPSRKKGQPLVDRRRPKKPPTAFFYFM
EDFRKTYKEENPSVKSMQEVGKACGEKWNTMTFEERVKYYDIATEKRAEYEKAVAEFDKK
KESGELSEESDYD
Download sequence
Identical sequences A0A0E0C5R0 A0A0E0N0E6 A2WTJ2 I1NQG3 Q5QLQ9
39946.BGIOSIBCE003084 39947.LOC_Os01g47600.1 ORGLA01G0210300.1 LOC_Os01g47600.1|PACid:21910538 OsIBCD002832 OMERI01G22590.1 LOC_Os01g47600.1|13101.m04922|protein XP_015620110.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]