SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5QWE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5QWE7
Domain Number 1 Region: 330-561
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-31
Family Laminin G-like module 0.072
Further Details:      
 
Weak hits

Sequence:  Q5QWE7
Domain Number - Region: 23-293
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000232
Family Pectate lyase-like 0.067
Further Details:      
 
Domain Number - Region: 622-709
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.0746
Family gamma-carbonic anhydrase-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5QWE7
Sequence length 1431
Comment (tr|Q5QWE7|Q5QWE7_IDILO) Type II secretory pathway component {ECO:0000313|EMBL:AAV81222.1} KW=Complete proteome; Reference proteome OX=283942 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR). GN=IL0379 OC=Idiomarinaceae; Idiomarina.
Sequence
MSLLKTLKFVIISVIAFASTPAMATNYNLPNNNLPGCSKSGNTYTCPNGLNLNFRDRIQI
SGNNSVVINVNGNFNLGSEMRINENGGAQQLTITTTGSYNGGFQSVINANISSQQNITLA
NENIFSGSLVAANDVSVGFRTNIDGSIRSTSGSVILQGENSITGNVDARDNVIVRFLTEV
NGNLNATNGNVVLEGQNDVSGAIFSGGDTILRFRSDVEGAITSNGRVVLEGENTVNGNII
AGDDVTLRYGSDVNGDIDADGSVTLDGANIVDGNINATDRVTIPNSSTVTGYVNAPQIID
ESNVQGETCDINNNEGPCGSEPPDQPLDGLGYWAFDQVEWRGQFGEVLDISGNGLHGQAL
RGANTSGFNPAIAGNPGTCRYGKFNGDNAVRVDNAQSIANAESVSVAFWFKGSATGQNQS
DRYQSLLVIGNGPTEGASGRFEVYRQDTRDGGGLYFEIRRNNGEIVNVEAGNTRQGQTNL
LDDNWHHLAASYDRNARRLTLYIDGQQADQTSFNGSSNLNAVAPRLYIGGQGIGENSFYG
EIDEVFIDDKVLTQSDVTTLKSITRPCNDQRPLCEDVWPVAFEVPNNVPKPFDLPDRSYN
TQLPAQLQPIDYLRTGNFGNTGFNYTTNGQTSRVYIDGDVTIQSGRRINVGGNANEMMLI
VTGDLTLEQDVQFNGYIYVAGNFLFERSFFFWQTSEVTGGVSVGGRSFATGNFGFFDPEV
NYQAPVEPIAGGNFCRASDTAPPVSPVHHYQLSYNSPALTCSAADIEVTACANASCSELY
EGSSTVQLNSTAGDWSTNPVSASPVGTTSLEQTNAGIYPLAVETTGTLPQPQNPTRCLVN
GNLSESCNIEFSDTGFIFTSGDNFEDTDIPSQVSAVPFSNLQLRAVETNSQTLACQAVTQ
PLNSVSMSMNCVDPDQCLMGASVNETEVTENNTSNISVSFTDGKAPLEINYKDAGAINLT
AQATLPNGKTLRGTSEAFVWRPASIDVEASQDASSNYEGTILAKAGDVFTARLAAINDEG
DVTPNFGNEANPETLQLMAQTEAVESYNGEITNADGFTKDGAGIFTNSGLTYTEVGSTRV
TAYIGSQNYLPGYHGSPVMLTTESEIGRFIPYEFQMETFDGFSGVCNRNNAGQGDEFYYI
GEAQLLGPSFALTAVNKNGETTKNYPTDVVEGELEFYPFNGANGSPELLNPGQLFATDVE
LEWGQNEESAGTASFKSPAPSVTYRRNGAEEGPYEDYKLGIQFNDSEGGNYYSVITESNL
PAAAQAPAFKLYDSVKLLYGRFVLDNIFGAEVDDLPLSGRAQFWNGDNFVINTNDNCFTV
SVSKLDVLSAIDPTKDPVISLDTESIELSDTPDSVSLTEGELQEAYSPMEDLLRWQAYGS
AAEFTFELTVPSFLQYDWDGDSNYQDNPTAEGTFGIYRGSDRQIYWQEVGW
Download sequence
Identical sequences Q5QWE7
gi|507384802|ref|YP_008033881.1| 283942.IL0379 gi|56459490|ref|YP_154771.1| WP_011233640.1.4909 WP_011233640.1.75540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]