SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5RDP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5RDP3
Domain Number 1 Region: 16-175
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-38
Family Dual specificity phosphatase-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5RDP3
Sequence length 223
Comment (sp|Q5RDP3|STYX_PONAB) Serine/threonine/tyrosine-interacting protein KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=STYX; OC=Catarrhini; Hominidae; Pongo.
Sequence
MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPILQKHGITHI
ICIRQNIEANFIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHG
NAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTI
QMMSPLQIERSLSVHSGTTGSLKRTHEEEDDFGTMQVATAQNG
Download sequence
Identical sequences A0A2I3H8M7 G3QHG7 Q5RDP3
ENSGGOP00000001796 ENSGGOP00000001796 NP_001153320.1.23681 XP_012359902.1.23891 XP_018865659.1.27298 ENSNLEP00000015284 ENSNLEP00000015284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]