SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5RGK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5RGK8
Domain Number 1 Region: 339-502
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.32e-29
Family Staphylococcal nuclease 0.0051
Further Details:      
 
Domain Number 2 Region: 522-666
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.7e-28
Family Staphylococcal nuclease 0.00093
Further Details:      
 
Domain Number 3 Region: 189-331
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 6.41e-27
Family Staphylococcal nuclease 0.0067
Further Details:      
 
Domain Number 4 Region: 17-168
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 2.09e-26
Family Staphylococcal nuclease 0.0026
Further Details:      
 
Domain Number 5 Region: 709-797
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.83e-20
Family Tudor domain 0.000018
Further Details:      
 
Domain Number 6 Region: 743-765,792-904
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.97e-16
Family Staphylococcal nuclease 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5RGK8
Sequence length 913
Comment (tr|Q5RGK8|Q5RGK8_DANRE) Staphylococcal nuclease domain-containing protein 1 {ECO:0000313|Ensembl:ENSDARP00000040404} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=snd1 OC=Cyprinidae; Danio.
Sequence
MASAVPAQVQSSQASAPQLQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGALA
RRAIQGQPDTKDTPDEPWAFQAREFMRKKVIGKEVCFTVENKTPQGREYGMVYLGKDTSG
ENIAESLVAEGLAMVRREGIRGNNPEQVRLCDLEDQAKSSKKGLWSEGGGSHTIRDLKYT
IENPRNFVDSLHQKPVNAIIEHVRDGCMVRALLLPDYYLVTVMLSGIKSPTFKREADGSE
TPEPFAAEAKFFTESRLLQRDVQIILESCPNQVILGTILHPNGNITELLLKEGFARCVDW
SMAVYTQGAEKLRAAERSAKERKVRIWKDYVAPTANLDQKDRQFVAKVMQVVNADAIVVK
LNSGEYKTIHLSSIRPPRLEGEEKNKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVT
VDYIRAATNAMEMGVPAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYD
ELLAAEARAIKNGKGLHSKKEVPIHRVADISGETQKAKQFFPFLQRAGRSEAVVEYVFSG
SRLKLYMPKETCLITFLLAGIECPRGSRNMPGGMQVAEPYSEEAMLFTKELVLQREVEVE
VESMDKAGNFIGWLHIEGVNLSVALVENALSKVHFTAERSSYYKTLVSAEESARQRKEKL
WANYEEKPKEEVAQVTEAKERVAKYRSVYVTEITDGLHFYAQDVETGTKLENLMESMRGE
IAAQPPVEGSFAPRRGEFCIAKFADGEWYRARVEKVESPAKVHVFYIDYGNREVLSSTRL
AALPPAFSTRTLPPQATEYAFAYIQVPQDEDARADAVDSVVRDIHNTQCLLNVEYSGSVC
PQVTLQFADTKEDVGLGLVKEGMVMVDIRKEKYLQKMVTEYLNAQESAKSARLNIWRYGD
FRDDDADEFGYRR
Download sequence
Identical sequences Q5RGK8
ENSDARP00000040404 NP_878285.3.45394 ENSDARP00000040404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]