SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5RI57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5RI57
Domain Number 1 Region: 24-108
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.74e-18
Family Synaptotagmin-like (S variant) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5RI57
Sequence length 134
Comment (tr|Q5RI57|Q5RI57_DANRE) Si:ch211-240l19.8 {ECO:0000313|EMBL:AAI48164.1, ECO:0000313|Ensembl:ENSDARP00000100169} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=CH211-240L19.8-001 OC=Cyprinidae; Danio.
Sequence
MAVFCDLRLVSLAVLMLASQLDFASASVRVFGLHARDLTGDPFGNEPDPYVKVWCGAVSG
GQTEYHKDNANPTWSAEFNFPNCKCGDDVKLEIWDKDKTFDDHLGTCNKLVQYGSFAVTC
YLNKGTFFYRYEAK
Download sequence
Identical sequences Q5RI57
7955.ENSDARP00000100169 ENSDARP00000100169 NP_001076399.1.45394 ENSDARP00000100169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]