SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5RJ97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5RJ97
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.86e-22
Family Tudor domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5RJ97
Sequence length 619
Comment (tr|Q5RJ97|Q5RJ97_DANRE) Lamin B receptor {ECO:0000313|Ensembl:ENSDARP00000015055} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=lbr OC=Cyprinidae; Danio.
Sequence
MPPARFQIGDTVMGRWPGSNLYYEVKVMSFDNKTRLYTVIYKDGTELELKESDITSVVIF
QTAGRSRSRSRSPGRSPGRSSARSPGRPRRSRSRSPARTPRRASSRSTEVRKEKLKEVLE
VRLTPVAMKHENNSSNSKSEKKEENNTAKAAPVVTEEKTETESENQTGGRYNLRRRKDQG
DGKAVELEKAVESEPLLQTKAPAAVKTADLEFGGRVGVLFLMFLLPVAVLVLLILCGQKD
ASLQSFPLELPALQSVWDCQVFGIVLLWLLFQAFLSLLPVGKLVEGMPLKNGKTLKYRIN
GFYALLLTAVAAGVAVYQEVDLSYIHAHFLQFYTSALLIATLLSIYLFIRSRWASKDELA
PGGNSGYIIYDFFMGRELNPRIKSFDIKFFCEMRPGLMGWVLINFAMLLAEMKQQNLENP
SPAMLLVNIFQLLWVIDGLWHEEKLLTMMDIMYDGFGFMLTFGDLAFVPFTFTCQAYYLV
NHPNELSVFWIITLIAMNGVGYYIFRKANSQKFAFRKNPSDPAVSHLKTIPTATGKSLIV
SGLWGFVRHPNYLGDIIMALAWSLPCGFNNLVPYFYLIYLVTLLVHRNARDERQCRKKYG
SAWEEYCKAVPYRIFPRVY
Download sequence
Identical sequences Q5RJ97
7955.ENSDARP00000015055 ENSDARP00000015055 XP_021324046.1.45394 ENSDARP00000015055 ENSDARP00000104747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]