SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5SEK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5SEK7
Domain Number 1 Region: 515-817
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-53
Family Duffy binding domain 0.0000197
Further Details:      
 
Domain Number 2 Region: 207-484
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.58e-47
Family Duffy binding domain 0.0000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5SEK7
Sequence length 1430
Comment (tr|Q5SEK7|Q5SEK7_PLARE) Erythrocyte invasion ligand PEBL/EBA-165 {ECO:0000313|EMBL:AAT77189.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRCDC_0421500 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MRKTLKLFYISGFLFSSRALCKLENYIKNEYDKENCVYIINNKVEKDYGSGMNNNNINID
KLPNGSLEILKVKKEALLGDKKNIDNKDIKEQLPENNKNFEEKILHKDICKLNKEHIEKE
GLYKPNTFKNIENDLLYKKGKLNFLYDYGMELLHINKAPMNRMNNSRGLGDGDMSFLDIS
NNNMNISNSLDSLNSLSFVDMKSIHRCIKKRAKGERDWVCNNKNTKEPNICVSDRKVQLC
TGNLIELPISDSTKEKFKEKLILAAQKEGSLLFEKFGKKYNEEFCLNLKWSYGDYGDIIK
GTDMEGLGRSIKVEFEIDRIFKRDNEKSAENRKKWWEEISSHIWNAMIKEHKENLPKDIK
ACSSDKPSDELQINRWLMEWAYDTDYNKNIWYNKLDDSKNKCNRICPKEELCKSECKKYK
TWIDKKNNDFTILSEIYLKYNKKTSLYKTAFEYLKHKWDKYKELNFSSIFDQLNAKYYNK
CICQNNKMENKALYVKIENICKNTELKSIYGELYCKEKGNNKIWQCINENIKDFPDVCSP
PRRQHLCLGNLDKDQFQNVNELDKFLNEIILGIRNEGKFLIEKYRRNMHENKYLDESACT
YLNYSFDDYKNIILGKDMWKDANSMKTENILKGNFEGIKANIVRMYPGYADLSLDEFRKQ
WWDQNKNQLWEAISCEFYNGHHTGVCLMEDDDDNQYLHWFREWKNDFCIEQNRWNNVLKE
SCIDKKVQPSSGESENTHDVDTVCSRSCTDYDDWIINKRKEYKMQSSKYKRDRSLFNNVI
QNLKPWEYLSMKCTECTCNLDTQTFVYPHKGYEDICKSIVKPYDPEDIKDEEFNEPYLNV
NSISVTSQDVTQRASSVEDVLSIRENVHLKPFKPKGDRQSSHVDQVGNTRQSESESKPSG
ANGRENPRTQSSTYNDDVITSSSSLGSSSGSDVSSSGVDVDEQEHKAKELLPPQTVIDGV
TQSAESTLSQHGKESSQEQHNLDGSSLSRHSTQDAGGSSTTSDVAHGTNSLFGSQIQDQA
ILSGESKPVTTSPSEHERSKMDTHAGVKNMEQVRNASADSSSEMSNGGRSGLKNKEMEGE
EVTGKKSKNDINLDDSTVHSRQYIIKNSGDGTPGKDHMNVLQGMDEHLENPSISERGGNV
LESEFNKLNSTSYRRDNNRIETTGGNNIDGLSNSYVHDGRDSQRHRMNINNRSRHGSLES
DIVVRGDDISNIEGEEEEEEEEEGANTLNNPRNVLNNMNSRTYNIEEYIYRDVNKVADDI
MRSYGSNRCTNDLSSNYCSKLKKESLSNVCTDEDSKNLCCSISDYCMKFFNFNSSGYHSC
MRKEFSNPAYKCFAGKSFSNMYYFAGGGLFFIILFFLGAKSSILNWSEDNGLNGTAFEEA
NFEDTAFEVTTGQDSAFEDYGENAYKIGLLMNQKIQSDKVSDYLEYHMDN
Download sequence
Identical sequences Q5SEK7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]