SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5SEK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5SEK8
Domain Number 1 Region: 451-732
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.42e-66
Family Duffy binding domain 0.000000348
Further Details:      
 
Domain Number 2 Region: 146-418
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.72e-45
Family Duffy binding domain 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5SEK8
Sequence length 1282
Comment (tr|Q5SEK8|Q5SEK8_PLARE) Erythrocyte invasion ligand BAEBL/EBA-140 {ECO:0000313|EMBL:AAT77188.1} OX=5854 OS=Plasmodium reichenowi. GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
YFNIYFLIPLIFLYNVIGINESIRGRTFYNRQDESSDISRVKSPELNNNHKTNIYDSDYE
DVNNKLINSFVENRSVKKKRSLGFINNKTRSYDIIPPSYSYRNDEFNSLSKIEDNSGNTN
SNNFANTSEISIGKDNKQYTFIQKRTHLFSCGIKRKSIKWVCRENSEKITVCVPDRKIQL
CIANFLNSRLETIEKFKEIFLISVNTEAKLLYNKNEGKDPSIFCNELRNSFSDFRSLFIG
DDMDFGGNTDRVKGYINMKFSDYYAEKNVEKLNNIKKEWWEKNKENLWNHMIVNHKENIS
NECATIPEEEPQINAWIKEWNENFWMEKKRLFLNIKDKCVENKKYEACFGGCRLPCSSYT
SFMKKSKTEMEVLTNLYKNKNSGEDKNKFLNDLFKKNDKTNLDDFFKNEKEYDDLCDCRY
TVSIIKSFLNGPAKNDVDTASKINVNDLRVFGCNYKSNNKKSWNCTGTFTNEFPGTCVPP
RRQTLCLGRTYLLHDGHEEHYKEHLLGASIYEAQLLKYKYKEKDENALCSIIQNSYADFA
DIIKGSDIMKDYYGKNMEESLNKVNKDKKSNEESLKIFREKWWDENKENVWKVMSAVLKN
KETCKDYDKFQKTPQFLRWFKEWGDDFCEERKEKMYSFESFKVECKKKDCDENACQNKCN
EYKKWIDLKKSEYDKQVEKYTKDKNNNIYDNIDEVKNKEANVYLKEKSKECNDVNFDDKI
FNESPNEYEDMCKKCDEIKYLNEIKYPKTKHDIYDIGTFSNTFGGRTPISINANINEQQN
GKDTSKTGNTETESDAGINVEKLSGDEKSSERREISDIKELSVTSNVNEASDALTLETED
TGENTLANLRKEDKSLLSTKNQTDLNGRSTLEEQTVHEQTNGSDTGVNVMTESNGSGITG
RKKENEIDGGHNEVHAASNTQSSVSNTSDIRKEHSESSLNRTTDTQDIKIGSSGNEQSDN
QKNNSHSSDDSDSLTIKHDPSEDNTQNIYDLQDSHKDTSNTLVSSQSDDEVNGIGDLDSS
GDSESGGGDTISKTHDVRPMNIVREKHVNNHDFIRSGMTNNNAHNQYITPNGNNGIIRGQ
EESDGGKVNSEHNRARSNFSFKNDHKKNIQEYNSRDTKRVREEIIKLSKQNKCDNEYSME
YCTYSDERNSSPGPCSREERKKLCCQISDYCLKYFNFYSIEYYSCIKSEIKSPEYKCFKS
EGRSNIPYFAAGGILVVIVLLLSSASRLGKSNEEYDIGEVNIEAAFEENNYLNKLSQIFN
QEVQETNISDYSEYNYNEKNMY
Download sequence
Identical sequences Q5SEK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]