SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5SZI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5SZI1
Domain Number 1 Region: 173-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 35-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000107
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5SZI1
Sequence length 272
Comment (sp|Q5SZI1|LRAD2_HUMAN) Low-density lipoprotein receptor class A domain-containing protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LDLRAD2; OC=Catarrhini; Hominidae; Homo.
Sequence
MEACCLLQLPQRLLLLGAAALTATALETADLAELCGQTWQGDGLLLRSHAASRRFYFVAP
DTDCGLWVQAAAPGDRIRFQFRFFLVYSLTPAPPALNTSSPAPADPCAPGSYLQFYEGPP
GAPRPLGSPLCGLNIPVPVASSGPFLGLRLVTRGRQPRVDFVGEVTSFRLGPCGAYFRCQ
NGRCIPSSLVCDPWGMDNCGDGSDQGSWSPADCRGPSPVPSQTGSTDAHTSRSLTPSPAL
GSAGSLWIAAERSSPAGRDPTRQDAALEGSTE
Download sequence
Identical sequences Q5SZI1
NP_001013715.2.87134 NP_001013715.2.92137 ENSP00000340988 ENSP00000340988 ENSP00000444097 ENSP00000340988 ENSP00000444097 9606.ENSP00000340988 gi|224591414|ref|NP_001013715.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]