SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5T7M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q5T7M9
Domain Number - Region: 145-190
Classification Level Classification E-value
Superfamily EF-hand 0.0158
Family Calmodulin-like 0.08
Further Details:      
 
Domain Number - Region: 197-317
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.051
Family RIO1-like kinases 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5T7M9
Sequence length 428
Comment (sp|Q5T7M9|FA69A_HUMAN) Protein FAM69A KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FAM69A; OC=Catarrhini; Hominidae; Homo.
Sequence
MARSLCPGAWLRKPYYLQARFSYVRMKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCK
KIICDKYKTGVIDGPACNSLCVTETLYFGKCLSTKPNNQMYLGIWDNLPGVVKCQMEQAL
HLDFGTELEPRKEIVLFDKPTRGTTVQKFKEMVYSLFKAKLGDQGNLSELVNLILTVADG
DKDGQVSLGEAKSAWALLQLNEFLLMVILQDKEHTPKLMGFCGDLYVMESVEYTSLYGIS
LPWVIELFIPSGFRRSMDQLFTPSWPRKAKIAIGLLEFVEDVFHGPYGNFLMCDTSAKNL
GYNDKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDQSTMKCTSEVIQ
PNLAKACQLLKDYLLRGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNLKTLLWK
KISYTNDS
Download sequence
Identical sequences A0A2J8VCX1 A0A2K6G1T6 H2PZE7 Q5R634 Q5T7M9
ENSP00000359333 ENSP00000359333 NP_001006606.2.87134 NP_001006606.2.92137 NP_001126623.1.23681 XP_003308263.1.37143 XP_012516560.1.63892 XP_012646378.1.48125 ENSP00000359333 9598.ENSPTRP00000001660 9606.ENSP00000359333 ENSPTRP00000001660 gi|165932391|ref|NP_001006606.2| ENSPTRP00000001660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]