SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5TF58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5TF58
Domain Number 1 Region: 412-480
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000366
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 
Weak hits

Sequence:  Q5TF58
Domain Number - Region: 57-87
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000628
Family Intermediate filament protein, coiled coil region 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5TF58
Sequence length 517
Comment (sp|Q5TF58|IFFO2_HUMAN) Intermediate filament family orphan 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=IFFO2; OC=Catarrhini; Hominidae; Homo.
Sequence
MVNSLLFGEMALAFGCPPGGGGGGCPGGGGGGGGAGPGPSPVTAALRDDLGSNIHLLKGL
NVRFRCFLAKVHELERRNRLLEKQLEQQQSERERRLRYKTFSREQAVQTGPELLRPPAPG
GGHGLSSGAAAGANANAVALGGLPPGGGSHPQHYGRLPGTIWSYTQVRRTGGGGVETVQG
PGVSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEEELAKRMNLQTMVDTL
QEAAQEADAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTKIQEKAMKVDMDICRRIDI
TAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDGEVNRFSDDEVGSMNITDE
MKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPTIDLQGEQEENLGNLIHET
ESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSMKRGLDVQMETCRRLIKGS
ADRNSPSPSSVASSDSGSTDEIQDEFEREADVEPMVS
Download sequence
Identical sequences A0A2I2YJY9 H2PY67 Q5TF58
gi|210147457|ref|NP_001129737.1| ENSP00000387941 ENSP00000387941 ENSGGOP00000005429 9606.ENSP00000387941 ENSP00000387941 NP_001129737.1.87134 NP_001129737.1.92137 XP_003307885.2.37143 XP_004024829.1.27298 ENSGGOP00000005429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]