SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5TGS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5TGS1
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000111
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5TGS1
Sequence length 186
Comment (sp|Q5TGS1|HES3_HUMAN) Hairy and enhancer of split 3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HES3; OC=Catarrhini; Hominidae; Homo.
Sequence
MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVP
RGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPC
TPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGS
PGDDLN
Download sequence
Identical sequences Q5TGS1
ENSP00000367130 9606.ENSP00000367130 gi|66912172|ref|NP_001019769.1| ENSP00000367130 NP_001019769.1.87134 NP_001019769.1.92137 ENSP00000367130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]