SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5TYL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5TYL5
Domain Number 1 Region: 477-561
Classification Level Classification E-value
Superfamily DEATH domain 1.45e-16
Family DEATH domain, DD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5TYL5
Sequence length 795
Comment (tr|Q5TYL5|Q5TYL5_CAEEL) Uncharacterized protein {ECO:0000313|EMBL:CCD61796.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=B0350.2 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKF
LGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQL
DDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKT
IKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQY
SGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTP
RDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLI
AKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAAT
EGRIGFMAEPKIRSDALPPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSALEK
DLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECKNTLKIWIHLKKEDAN
QDNLDQALRQIGRDDIVRSIAYGEPDALINYSQADSPSQKREPIRHFEEVPAATLVKREV
RTEDLVTREPVQPTHHVEQATTVVQEPSYSAPVHHSPVPEEPEMEEEAPVAEMRTVVRTE
RHVHDSEDGPVVEERTITTTYEDDVAVNENIVDRTVPLNEDEQQKWEELNRLADESSPSP
AQRSTIVAESTSEQVPEDVEQSVESESHREDDGTIVTTTVTTSHISESPSGSPTRRSVEP
EEHRHSQHEDHEGST
Download sequence
Identical sequences Q5TYL5
B0350.2d NP_001021267.1.50509 B0350.2d.1 B0350.2d.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]