SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5U4C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5U4C9
Domain Number 1 Region: 210-541
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-85
Family Protein kinases, catalytic subunit 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5U4C9
Sequence length 599
Comment (sp|Q5U4C9|DYRK2_MOUSE) Dual specificity tyrosine-phosphorylation-regulated kinase 2 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Dyrk2 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLTRKPSAAAPAAYPTGRGGDTAVRQLQASPGIGAGAPRSGVGTGPPSPIALPPLRASNA
TTTAHTIGGSKHTMNDHLHLNSHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPGV
PERQLESIHRRQGSSTSLKSMEGMGKVKASPMTPEQAMKQYMQKLTAFEHHEIFSYPEIY
FLGPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDH
KVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFE
LLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRS
SIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLL
PGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRS
RRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKP
PTGEKTAVKRVTESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS
Download sequence
Identical sequences Q5U4C9
10090.ENSMUSP00000004281 NP_001014412.1.92730 ENSMUSP00000004281 ENSMUSP00000004281 ENSMUSP00000004281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]