SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5U589 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5U589
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.69e-74
Family BAR domain 0.0000000514
Further Details:      
 
Domain Number 2 Region: 273-347
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-23
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5U589
Sequence length 351
Comment (tr|Q5U589|Q5U589_XENLA) LOC495333 protein {ECO:0000313|EMBL:AAH84795.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=LOC495333 OC=Xenopus.
Sequence
MSVAGLKKQFHKASQLFSEKISGAEGTKLDDDFQEMERKIDITNKVVAELLSKTTEYLQP
NPAYRARLGMLNTMSKIRGQVKTTGYPQTEGLLGDCMLRHGRELGEESEFGCALLDGGEC
MKQMAEVKDSLDINVKQNFIDPLQSLQDKDLKEILYHLKKLEGRRLDFDYKKKRQGKIPD
EEIRQAVEKFEESKELAERSMFNFLENDIEQVSQLSVLVETALDYHRQSAQILEDLHNRL
HNRINTASSRPKRELQHRSIIATLESNEKLHHNGIPSDSPVKLSGSSDPLDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWFEGMVNGESGFFPINYVEVVLPLP
Download sequence
Identical sequences Q5U589
gi|148228738|ref|NP_001088468| gi|54311447|gb|AAH84795| NP_001088468.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]