SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5VSE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5VSE2
Domain Number 1 Region: 89-268
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-50
Family Ypt/Rab-GAP domain of gyp1p 0.0034
Further Details:      
 
Domain Number 2 Region: 243-354
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.57e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5VSE2
Sequence length 423
Comment (tr|Q5VSE2|Q5VSE2_DANRE) USP6 N-terminal-like {ECO:0000313|Ensembl:ENSDARP00000113866} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:ch211-198d18.2 OC=Cyprinidae; Danio.
Sequence
MQVLQIVKELVSPSRRRAASDSEQDAAVKLEQERAEILAKYDKGKEKAEVEPWEETNFEL
YKAVDRFGFLHYFHHNVALERQKQLEVERTTKWLKMLKSWEKYKNSDKLVRRIYKGIPLQ
LRGQVWCLLLDIPKIKEEKKDFYEKLKIRARGLSPDVRQIDLDVNRTYRNHIMFMHRYDV
KQQDLFHVLTAYSVYNTEVGYCQGMSQITALLLIYMNEEDAFWALVKLLSGQRHTMHGFF
VPGFPKLMRFQEHHDRILQKMMPKLKQHLDNQEVYTSLYTMKWFFQCFLDRTPFTLTLRI
WDIYILEGERVLTAMSYTILKLHKKTLLKLSMEELVKFLQVTLSNDFFFEDDFVIEQLQN
SMSELRRSKLELPPPGKEDEYPKKPLGQLPPEPPGLAAAATNHVANGQPVGQTGEGLPPR
GPS
Download sequence
Identical sequences Q5VSE2
ENSDARP00000113866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]