SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q5VWM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5VWM5
Domain Number 1 Region: 165-410
Classification Level Classification E-value
Superfamily RNI-like 9.03e-21
Family 28-residue LRR 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5VWM5
Sequence length 478
Comment (sp|Q5VWM5|PRAM9_HUMAN) PRAME family member 9/15 {ECO:0000305} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PRAMEF15 OC=Catarrhini; Hominidae; Homo.
Sequence
MKMSIRTPPRLLELAGRSLLRDQALAMSTLEELPTELFPPLFMEAFSRRRCEALKLMVQA
WPFRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVRPRRWKLQVLDLQDVCENFWMVWSE
AMAHGCFLNAKRNKKPVQDCPRMRGRQPLTVFVELWLKNRTLDEYLTYLLLWVKQRKDLL
HLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLV
LSHMDVSRYVSPEQKKEIVTQFTTQFLKLRCLQKLYMNSVSFLEGHLDQLLSCLKTSLKV
LTITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLVPLQILLEKVAATLEYLDLD
DCGIIDSQVNAILPALSRCFELNTFSFCGNPICMATLENLLSHTIILKNLCVELYPAPRE
SYGADGTLCWSRFAQIRAELMNRVRDLRHPKRILFCTDYCPDCGNRSFYDLEADQYCC
Download sequence
Identical sequences Q5VWM5
gi|148356236|ref|NP_001091846.1| gi|61102721|ref|NP_001010890.1| HR6151 ENSP00000330156 ENSP00000365322 9606.ENSP00000327917 9606.ENSP00000365322 NP_001091846.1.87134 NP_001091846.1.92137 ENSP00000327917 ENSP00000365322 ENSP00000365322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]