SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5VZ29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5VZ29
Domain Number 1 Region: 3-128
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.8e-23
Family Pyridoxal-dependent decarboxylase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5VZ29
Sequence length 129
Comment (tr|Q5VZ29|Q5VZ29_HUMAN) Glutamate decarboxylase 2 {ECO:0000313|Ensembl:ENSP00000365424} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GAD2 OC=Catarrhini; Hominidae; Homo.
Sequence
MNILLQYVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTG
HPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGS
GDGIFSPGT
Download sequence
Identical sequences A0A2J8MNL0 A0A2J8SUR0 A0A2K5YHP4 A0A2K6NS18 Q5VZ29
ENSP00000365424 ENSP00000365424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]