SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5YLY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5YLY5
Domain Number 1 Region: 335-405
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.82e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 193-253
Classification Level Classification E-value
Superfamily PH domain-like 0.00000517
Family Phosphotyrosine-binding domain (PTB) 0.054
Further Details:      
 
Weak hits

Sequence:  Q5YLY5
Domain Number - Region: 10-87
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00837
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5YLY5
Sequence length 488
Comment (tr|Q5YLY5|Q5YLY5_ORYSJ) cDNA clone:001-033-E06, full insert sequence {ECO:0000313|EMBL:BAG87563.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_22693 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MHPSGEYSPYYQPYPSPTSAPLATYPSASAPPYTPYPATDYAAPAAYPTYPPPPADPPQY
APPPAAPQPQPYYPYEPPPHNPAPSPYPSLDRAGSYGYGSGSQELYPPKPAGGGWSDDGV
YAYSGGGGDAPEPYGARGTAPRSNSPLFDDYGRSIGSTKERGGGGGGGGGSSASPKVVRA
VPKVETSEDTSGGVQKFRVKLLPEGAGSPMDVLCQVGLDGIRMLDPNTSRTLRIYPLETV
TRWDVLDSSIFAFWSKSSVDFEARRIRLKSNSYTTNTILDTVTAASVQFKEMGGSSISRS
RAIADAAKPPEQQNDRRKNFLDWRNLMKPMNEEKDHWVPDEAVTKCTACTADFSAFNRRH
HCRNCGDIFCDKCTQGRTPLTTDADAQPVRVCDRCMAEVSQRLNNAREAANRPIVHSHED
LAKKLKDAMDINKKSSSASSRSTDGSSRRMREVACPTCTVHLQVQVPTSGSETIECGVCQ
QPFLVSAR
Download sequence
Identical sequences Q5YLY5
LOC_Os06g50840.1|PACid:21931897 39947.LOC_Os06g50840.1 LOC_Os06g50840.1|13106.m05467|protein XP_015643100.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]