SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5YNM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5YNM0
Domain Number 1 Region: 2-270
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.16e-30
Family Haloperoxidase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5YNM0
Sequence length 275
Comment (tr|Q5YNM0|Q5YNM0_NOCFA) Uncharacterized protein {ECO:0000313|EMBL:BAD60221.1} KW=Complete proteome; Reference proteome OX=247156 OS=Nocardia farcinica (strain IFM 10152). GN=NFA_53690 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MHTVTSADGTAIAYEQIGAGTAGTVILVGGALEDRRSPKLTDLAAALAALDLTVLVYDRR
GRGDSGDTPGVYQAGHEIDDLAALVAAAGGAAALFGWSAGAVLALRAAASGRIPGLTRVV
AFEPPFVVDRTGHVPPQDAGTRLEQLLAEGKTGKAAAYYLRKVMGVPWTMVTTMRLTPYW
RTMKNLATSTAHDWAVIGPYTRGEALRPADWAELTVPVLVLAGTDSAASVKTAAAATAAA
LPLAHHRELPRLGHNQNVELIAAPTADFLTGKGAI
Download sequence
Identical sequences Q5YNM0
247156.nfa53690 WP_011211903.1.78782 gi|54027343|ref|YP_121585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]