SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5ZE75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q5ZE75
Domain Number - Region: 84-176
Classification Level Classification E-value
Superfamily PH domain-like 0.00738
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5ZE75
Sequence length 222
Comment (tr|Q5ZE75|Q5ZE75_ORYSJ) Putative myosin heavy chain-related {ECO:0000313|EMBL:BAD61165.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_02648 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MDRFRPLRRIQVDPEPAAAAPPPPAAAAANGGAGEDVSAAPAAGLLMASRVRRRSAVYRD
CKGDYIGVPNDPCLTKILSKQGDNKVLFADKVLKFTQSGKMKRRILVITDFALYLVDPDA
DILKRRIALAAVDKLCISKLSDNFFAIIVPTEYDCLMASTRKKEIVDIIIKAIKSNSEYQ
PQVASSNRFEYHAAAEVIKEVEFEEAEGGVKTRITHKAKAKS
Download sequence
Identical sequences Q5ZE75
LOC_Os01g43360.1|13101.m04478|protein XP_015624681.1.37577 LOC_Os01g43360.1|PACid:21903269 39947.LOC_Os01g43360.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]