SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5ZK41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5ZK41
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-51
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 188-325
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-19
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 3 Region: 324-397
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q5ZK41
Sequence length 427
Comment (tr|Q5ZK41|Q5ZK41_CHICK) Neuronal guanine nucleotide exchange factor {ECO:0000313|Ensembl:ENSGALP00000052175} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=RCJMB04_13f18 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MFELVTSEASYCKSLNLLVSHFMENERLKKILHQSEAHILFSNVLDVKAVSERFLLDLER
RVEENIVISDVCDIVYQHTVDHFSVYITYVSNQTYQERTYKQLLQDKPAFREVITQLELD
PMCRGLSFSSFLILPFQRITRLKLLVQNILKKVEEKSERETTALEAHKELETVVKACNEG
VRKMSRTEQMISIQKKLEFKIKSVPIISHSRWLLKQGELQQMNGPKTSRTLRTKKLFREI
YLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQSLANVFILRLLENADDREA
SYMLKASSQSEMKRWMISLAPNRRTKFVSFTSRLSDCPQIQCVHPYVAQQPDELSLELAD
VLNILDKTDDGWIFGERLHDQERGWFPSSIGEEILNPKIRAQNLKECFRVHKSDDSQRRK
LGSRNRQ
Download sequence
Identical sequences G1MSA6 Q5ZK41
ENSGALP00000040510 ENSMGAP00000001169 NP_001010841.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]