SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5ZL04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5ZL04
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.83e-52
Family APC10-like 0.0000000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5ZL04
Sequence length 185
Comment (tr|Q5ZL04|Q5ZL04_CHICK) Anaphase-promoting complex subunit 10 {ECO:0000256|PIRNR:PIRNR028841} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=RCJMB04_8g15 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEVRQLELVEPSGWI
HVPLTDTHKKPIRTFMIQIAVLANHQNGRDTHMRQIKVYTPVEESSIGKFPRCTTIDFMM
YRSIR
Download sequence
Identical sequences Q5ZL04
NP_001008467.1.86415 XP_015131660.1.86415 XP_015131661.1.86415 ENSGALP00000041606 9031.ENSGALP00000016158 ENSGALP00000016158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]