SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q61066 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q61066
Domain Number 1 Region: 209-471
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.42e-65
Family Nuclear receptor ligand-binding domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q61066
Sequence length 472
Comment (sp|Q61066|NR0B1_MOUSE) Nuclear receptor DAX-1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Nr0b1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGAQPVLGGERLSGGQAR
SLLYRCCFCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAPCWGCACGSAEPLVGRE
GLPAGQAPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSREAPEAHRRGEWWQLSYCT
QSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQISVASGTPVSADQTPATPQEQPRAPWWDA
SPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQILPLDQQLVLVRSCWAPLLMLE
LAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQATEQPQMVSAEAGHLLPAAAV
QAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCVKYIEGLQWRTQQILTEHIRMM
QREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAVSMDDMMLEMLCAKL
Download sequence
Identical sequences Q53ZY9 Q61066
NP_031456.1.92730 ENSMUSP00000026036 10090.ENSMUSP00000026036 ENSMUSP00000026036 ENSMUSP00000026036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]