SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q61078 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q61078
Domain Number 1 Region: 37-150
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000488
Further Details:      
 
Domain Number 2 Region: 244-321
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.41e-31
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 447-508
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000222
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q61078
Sequence length 520
Comment (tr|Q61078|Q61078_MOUSE) Wiscott-Aldrich Syndrome protein homolog {ECO:0000313|EMBL:AAA85515.1} OX=10090 OS=Mus musculus (Mouse). GN=N-3AP1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MNSGPGPVGGRPGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATTVVQLYLALP
PGAEHWTMEHCGAVCFVKDNPQKSYFIRLYALQAGRLLWEQELYSQLVYLTPTPFFHTFA
GDDCQVGLNFADESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPINEERRGGLPPVP
PHPGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADI
GAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQG
GLEAVRQEMRRQEPLPPPPPPCRGGGGGGGGGGGGGGGGGGQPLRPPVLGSNKGRSPPLP
PVPMGGAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPP
PPCPGSGPAPPPLPPTPVSGGSPAPGGGRGALLDQIRQGIQLNKTPGALENSVQQPPAQQ
SEGLVGALMHVMQKRSRVIHSSDEGEDQTGEDEEDDEWDD
Download sequence
Identical sequences Q61078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]