SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q61166 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q61166
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-51
Family Calponin-homology domain, CH-domain 0.00000016
Further Details:      
 
Domain Number 2 Region: 194-254
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.62e-21
Family EB1 dimerisation domain-like 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q61166
Sequence length 268
Comment (sp|Q61166|MARE1_MOUSE) End-binding protein 1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Mapre1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKEYDPVAARQGQETAVAPSLVAPALSKPKKPLGSSTAAPQRPIATQRTTAAPKAGPGMV
RKNPGVGNGDDEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY
Download sequence
Identical sequences Q3U4H0 Q61166
10090.ENSMUSP00000028981 NP_031922.1.92730 ENSMUSP00000028981 ENSMUSP00000028981 ENSMUSP00000028981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]