SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q622X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q622X0
Domain Number 1 Region: 171-211,282-373
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-22
Family Voltage-gated potassium channels 0.0044
Further Details:      
 
Domain Number 2 Region: 397-489
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000222
Family Voltage-gated potassium channels 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q622X0
Sequence length 593
Comment (sp|Q622X0|UNC58_CAEBR) Uncoordinated protein 58 KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=unc-58 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MFFYSPNVASSSSASHRRGTLTHQHHLHVGHLDTRLSVQIPEILSRNFGHHDPERARLVP
EHLRFLVDENQELWTGGNQPPVGILELCAASPVDSVFSTNDARRHSQRKLILRRPTISIQ
EDGKIIIDHVTARWEGANINSQSALLDADDGATVITDTIKDDQEDKEPKSCPQQTVKYIK
ILLPHVILVSVLIGYLCLGAWILMLLETRTELLSRSKKLVRLTNLMSNFTAESWRMLSDA
QHGSITMDEGEWAATFREWMVRVSETVDDRRPIRRELNRPDDLSNMHNKWTFPTALLYVL
TVLTTCGYGEVSVDTDVGKVFSVAFALVGIPLMFITAADIGKFLSETLLKFVSFWNRSVR
KVKQWMSRVRHGRRKSLQSTGGQNDTLDILGVDGTEEKLWFPIGAYVSCICLYCSMGSAM
FINWERTWSFIHAFHFGFNLIVTVGLGDIVVTDYIFLSLIVAFVIVGLSVVTMCVDLAST
HLKAYFTRIHYFGRAKRFLGMSEELKEIVALLGAMRRKKGGKVTWNDVRDFLDNELRDRP
FEPHELLMKLRFIDETSSGMSTIRHNSFQSDFFRESEYIRRVAALRPEQPAYL
Download sequence
Identical sequences Q622X0
CBG01980 6238.CBG01980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]