SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q63762 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q63762
Domain Number 1 Region: 39-156
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-30
Family C-type lectin domain 0.00000527
Further Details:      
 
Domain Number 2 Region: 252-317
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 3 Region: 197-261
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000032
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 157-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q63762
Sequence length 372
Comment (tr|Q63762|Q63762_RAT) L-selectin {ECO:0000256|PIRNR:PIRNR002421} OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_45999 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MVFPWRCQSAQRGSWSFLKLWIWTLLCCDLLPHHGTHCWTYHYSERSMNWENARKFCKHN
YTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTWTWVGTNKTLTKEAENWGTGEPN
NKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPESCNRHGECVETINNNTC
ICDPGYYGPQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTE
CGASGNWTYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERK
TVCRSSGSWSSPSPICQKTKRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK
GKKSQERMDDPY
Download sequence
Identical sequences Q63762
ENSRNOP00000003733 10116.ENSRNOP00000003733 ENSRNOP00000003733 NP_062050.3.100692 NP_062050.3.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]