SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q64143 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q64143
Domain Number 1 Region: 349-456
Classification Level Classification E-value
Superfamily SH2 domain 1.16e-31
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 54-162
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-31
Family SH2 domain 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q64143
Sequence length 461
Comment (sp|Q64143|P55G_MOUSE) p55PIK KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Pik3r3; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTPAVTNGMKDSFISL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSEPLTFTSVVELINHYHHESLAQYNPKLDVKLTYPVSRFQQDQLVKEDNIDAVGKN
LQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKLRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHRGVRQRRLNAWLGIKNEDSDESYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPTLCR
Download sequence
Identical sequences Q3UXE9 Q64143
10090.ENSMUSP00000030464 ENSMUSP00000030464 NP_853616.1.92730 XP_017175528.1.92730 XP_017175529.1.92730 ENSMUSP00000102099 ENSMUSP00000030464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]