SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q64337 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q64337
Domain Number 1 Region: 389-438
Classification Level Classification E-value
Superfamily UBA-like 1.96e-17
Family UBA domain 0.00012
Further Details:      
 
Domain Number 2 Region: 112-173
Classification Level Classification E-value
Superfamily RING/U-box 1.18e-16
Family ZZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 44-97
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000227
Family PB1 domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q64337
Sequence length 442
Comment (sp|Q64337|SQSTM_MOUSE) Ubiquitin-binding protein p62 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Sqstm1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASFTVKAYLLGKEEATREIRRFSFCFSPEPEAEAQAAAGPGPCERLLSRVAVLFPTLRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFS
HSRWLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDGRPCPTAESASAPPEDPNVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPTTPESSSTGTEDKSNTQPSSCSSEVSKPDG
AGEGPAQSLTEQMKKIALESVGQPEEQMESGNCSGGDDDWTHLSSKEVDPSTGELQSLQM
PESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQ
TKNYDIGAALDTIQYSKHPPPL
Download sequence
Identical sequences Q64337
10090.ENSMUSP00000099835 ENSMUSP00000099835 NP_035148.1.92730 ENSMUSP00000099835 ENSMUSP00000099835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]