SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q64FW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q64FW2
Domain Number 1 Region: 64-367,534-569
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.52e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q64FW2
Sequence length 609
Comment (sp|Q64FW2|RETST_MOUSE) PPAR-alpha-regulated and starvation-induced gene protein KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Retsat; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MWITALLLAVLLLVILHRVYVGLYAASSPNPFAEDVKRPPEPLVTDKEARKKVLKQAFSV
SRVPEKLDAVVIGSGIGGLASAAVLAKAGKRVLVLEQHTKAGGCCHTFGENGLEFDTGIH
YIGRMREGNIGRFILDQITEGQLDWAPMASPFDLMILEGPNGRKEFPMYSGRKEYIQGLK
KKFPKEEAVIDKYMELVKVVARGVSHAVLLKFLPLPLTQLLSKFGLLTRFSPFCRASTQS
LAEVLQQLGASRELQAVLSYIFPTYGVTPSHTAFSLHALLVDHYIQGAYYPRGGSSEIAF
HTIPLIQRAGGAVLTRATVQSVLLDSAGRACGVSVKKGQELVNIYCPVVISNAGMFNTYQ
HLLPETVRHLPDVKKQLAMVRPGLSMLSIFICLKGTKEDLKLQSTNYYVYFDTDMDKAME
RYVSMPKEKAPEHIPLLFIAFPSSKDPTWEERFPDRSTMTALVPMAFEWFEEWQEEPKGK
RGVDYETLKNAFVEASMSVIMKLFPQLEGKVESVTGGSPLTNQYYLAAPRGATYGADHDL
ARLHPHAMASIRAQTPIPNLYLTGQDIFTCGLMGALQGALLCSSAILKRNLYSDLQALGS
KVKAQKKKM
Download sequence
Identical sequences Q64FW2
ENSMUSP00000068568 NP_080435.3.92730 ENSMUSP00000068568 10090.ENSMUSP00000068568 ENSMUSP00000068568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]