SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q66IS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q66IS0
Domain Number - Region: 13-92
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000492
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q66IS0
Sequence length 108
Comment (tr|Q66IS0|Q66IS0_XENLA) MGC85354 protein {ECO:0000313|EMBL:AAH81225.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=MGC85354 OC=Xenopus.
Sequence
MAAVGASELLLKSVKSIAVRFCPFEPNVRHVREFVEKINSKKIRSTNANCDIAVDIRHDR
SEPCVDVLFADGERLVIKGSNVTSKEMLLALNVKCASKDQQAKDSGRK
Download sequence
Identical sequences Q66IS0
NP_001087787.1.7800 gi|148224662|ref|NP_001087787| gi|51703951|gb|AAH81225|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]