SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q67UP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q67UP1
Domain Number 1 Region: 28-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.11e-30
Family BAR domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q67UP1
Sequence length 623
Comment (tr|Q67UP1|Q67UP1_ORYSJ) cDNA clone:J023101N14, full insert sequence {ECO:0000313|EMBL:BAG94645.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_06904 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MKSPLLRLKGFGHHQQHRERKSRQPQPQPTPAKLDELADAAQDVEEMRNCYDGFISAAAA
TTNGVYEFAEALEELGSCLLAKPVLNDDDDDSGRVLMMLGKAQYELQKSADRYRTNIIHT
ITTPSESLLKELQTLEEMKQQCDMKRDAYETMRASYSDKGGSRHSKTESFSTEQLDASFL
EYQEDSALFTFRLKSLKQGQFQSLLTQAARHHAAQLSFFRKGLKCLEALEPRVKAISEKH
HIDYNFSGLEDDGSDNDGYSTYDSCSDDGELSFDYEINDRDQDFLTSRGSMDFDKSDQTT
SPKPIKENKQEEAKQAEAEIVFPQLKPEFATHSAPLFAGNLLDETDRLRQMRPSSTKHSY
RLPTPVGADNPVPSGSHRLHHSAQFFETKPHAPTNLWHSSPLTKDYNGAMHNAATKPSSS
SSTDDLKKLKRESWSGPIPIKAGSGGKPFSQADHRPSPTMAYPGAMPAAKPHVRHASSSS
VSPKVSPKMSPVPPASSLKISELHLLPLPPANVDPVRPSGLVGYSGPLVSKRAPTPARAS
PKASRTASPLPRPPAALARSYSIPSNSQRTPIITVNKLLEAKHSREGSDASSPPLTPLSL
SDLCHQEKAGKAAAGNTRRKETL
Download sequence
Identical sequences Q67UP1
39947.LOC_Os02g31080.1 LOC_Os02g31080.1|PACid:21921895 XP_015627747.1.37577 LOC_Os02g31080.1|13102.m03401|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]