SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q68UT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q68UT7
Domain Number 1 Region: 65-321
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-85
Family Protein kinases, catalytic subunit 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q68UT7
Sequence length 714
Comment (sp|Q68UT7|HUNK_PANTR) Hormonally up-regulated neu tumor-associated kinase KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=HUNK; OC=Catarrhini; Hominidae; Pan.
Sequence
MPAAAGDGLLGEPAAPGGGGGAEDAARPAAACEGSFLPAWVSGVPRERLRDFQHHKRVGN
YLIGSRKLGEGSFAKVREGLHVLTGEKVAIKVIDKKRAKKDTYVTKNLRREGQIQQMIRH
PNITQLLDILETENSYYLVMELCPGGNLMHKIYEKKRLEESEARRYIRQLISAVEHLHRA
GVVHRDLKIENLLLDEDNNIKLIDFGLSNCAGILGYSDPFSTQCGSPAYAAPELLARKKY
GPKIDVWSIGVNMYAMLTGTLPFTVEPFSLRALYQKMVDKEMNPLPTQLSTGAISFLRSL
LEPDPVKRPNIQQALANRWLNENYTGKVPCNVTYPNRISLEDLSPSVVLHMTEKLGYKNS
DVINTVLSNRACHILAIYFLLNKKLERYLSGKSDIQDSLCYKTRLYQIEKYRAPKESYEA
SLDTWTRDLEFHAVQDKKPKEQEKRGDFLHRPFSKKLDKNLPSHKQPSGSLMTQIQNTKA
LLKDRKASKSSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQP
GPGSTGIPHKEDPLMLDMVRSFESVDRDDHIEVLSPSHHYRILNSPVSLARRNSSERTLS
PGLPSGSMSPLHTPLHPTLVSFAHEDKNSPPKEEGLCSPPPVPSNGPMQPLGSPNCVKSR
GRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPVNLAFDMADGVKTQC
Download sequence
Identical sequences A0A2J8MPZ7 Q68UT7
ENSPTRP00000023839 ENSPTRP00000023839 9598.ENSPTRP00000023839 NP_001065290.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]