SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q68X01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q68X01
Domain Number 1 Region: 196-355
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 5.89e-68
Family RalF, C-terminal domain 0.0000366
Further Details:      
 
Domain Number 2 Region: 7-192
Classification Level Classification E-value
Superfamily Sec7 domain 5.1e-55
Family Sec7 domain 0.00000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q68X01
Sequence length 454
Comment (tr|Q68X01|Q68X01_RICTY) Sec7-domain containing protein transport protein {ECO:0000313|EMBL:AAU03841.1} KW=Complete proteome OX=257363 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington). GN=RT0362 OC=Rickettsiaceae; Rickettsieae; Rickettsia; typhus group.
Sequence
MDSLLKNEVIKLFNDKQKSGITRIKKWCADNNKDFIEETAKFFYEEKSNLNLEFVGDYLG
TDGVDNQKVLESFTKKFDFKDKDYLESLRRFLQSFKLPGEAQKIDRLVESFGTHYYEQNL
NIDINSKDAAYILAYQAIMLNTDLHNPSIAKSKKMTFEQLKNNLKGTNENKNFNDNFLKK
IYDEIEAKPFKLNFVDSSPGYQINNISSQNDKVFKQLNQFLEEKRNIQNIFPKLQNNNLT
IEFKNAKTFLNKFTGYKGNVIIQDEQCGKAEIQVYKPSIFSRWFLGEKSKIIIQPLREDG
KQPSEQSLELAAQITASFETEVTSIKATYDYLKEDLKSKYDNIRNAKQELERISTIAEGH
KNIKTEVVYQINQPVKNSVAVSTISVVSPMSKDDIHINPPPLPLPKSIPNVVKKAAKDIS
KQIPQERDNHKEELSKVLEVQRKKIDKQNSGRVV
Download sequence
Identical sequences Q68X01
WP_011190825.1.11799 WP_011190825.1.3094 WP_011190825.1.57022 gi|383843178|ref|YP_005423681.1| gi|51473566|ref|YP_067323.1| gi|383752341|ref|YP_005427441.1| 257363.RT0362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]