SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q69ZK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q69ZK6
Domain Number 1 Region: 1964-2158,2198-2343
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.51e-38
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.074
Further Details:      
 
Weak hits

Sequence:  Q69ZK6
Domain Number - Region: 1654-1684
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00126
Family TFIIH p44 subunit cysteine-rich domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q69ZK6
Sequence length 2350
Comment (sp|Q69ZK6|JHD2C_MOUSE) Jumonji domain-containing protein 1C KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Jmjd1c; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MQGPYSLNGYRVRVYRQDSATQWFTGIITHHDLFTRTMIVMNDQVLEPQNVDPSMVQMTF
LDDVVHSLLKGENIGITSRRRSRASQNISTVHGHYTRAQANSPRPAMNSQAAVPKQNTHQ
QQQQRSIRPNKRKGSDSSIPDEEKMKEDKYDCVSRGENPKGKNKHVVTKRRKPEEAEKRL
SMKRLRTDNASDASESSDAESSSKRVTETSSSEPMPEYEPKNKVTSKVNGEEGQSQAAEE
AGEETLIDTRPPWDQMQEDKNHNEGEKPKSTDSHLQDKMTLRSSEQATVADHNSNDSVLQ
ECNVENQRTVELLPKDRLVSRTPTPKCVTDIKNDTHSERAAQENLNTFGLQTPENMDPNV
SDSKHSNAKYLETAKQDCDQSWVSDVVKVDLTQSSVTNAPSGSDKRDTEKERNHYVSYMS
SLSAVSVTEDQLHKRSPPPETIKAKLTTSVDTQKAKSSSSPEVVKPKITHSPDSVKSKAA
YGNSQAVGERRLANKIEHELSRGSFHPVPTRGSALETTKSPLIIDKNEHFTVYRDPALIG
SETGANHISPFLSQHPFSLHSSSHRTCLNPGTHHPALTPGPHLLAGSTSQTPLPTINTHP
LTSGPHHPVHHPHLLPTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQS
PHLLGQAHPSASYNQLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRRNSP
SPWLHQPTPVTSADGIGLLSHIPVRPSSAEPHRPHKITVHSSPPLTKTLADHHKEELERK
AFMEPLRSNASTSVKGDLDLNRSQAGKDCHLHRHFVGPRPPQETGERLNKYKEEHRRILQ
ESIDVAPFTTKIKGHEVERENYSRVVPSSSSPKSHAIKQDKDVDRSVSEIYKMKHSVPQS
LPQSNYFTTLSNSVVNEPPRSYPSKEVSNIYTEKQNNNLSATANPQTHSFISSLSKPPPL
IKHQPESESLVGKIPDHLPHQSASHSVTTFRSDCRSPTHLTVSSTNALRSMPALHRAPVF
HPPIHHSLERKESSYSSLSPPTLTPVMPVNAGGKVQESQKPPTLIPEPKDSQSNFKNSSD
QSLTEMWRSNNNLNREKAEWPVEKSSGKSQAAVASVIVRPPSSTKVDSVPSVPLASKDRV
CERSSSGANKTDYLKPEAGETGRIILPNVNLESAHVKSEKNFEAVSQGNVPVSVMSAVNV
VSTTKADVFTSAATTTSVSSLSSAETSYSLSNTISASTPFECTSSKSVVSQAVAQAKDCT
VSTAVPGTLACSKTGSAVQPGSGFSGTTDFIHLKKHKAALAAAQFKNSSVSEAELNTVRN
QTVAASLPLDSTMTCTASNKAISVGNGPAAQSSQPNYHTKLKKAWLTRHSEEDKNTNKME
NSGNSVSEIIKPCSVNLIASTSNDIENRADGRVAVDKYGRDEKVSRRKAKRTYESGSESG
DSDESESKSEQRTKRQPKPTYKKKQNDLQKRKGEVEEDSKPNGVLSRSAKDKSKLKLQNS
NSAGVPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSKKGEESTHSP
VFCRFYYFRRLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENYEDDEVDVETSKYILDII
GDKFCQLVTSEKTALSWVKKDAKIAWKRAVRGVREMCDACEATLFNVHWVCRKCGFVACL
DCYKAKERKSSRDKELYAWMKCVKGQPHDHKHLMLTQIIPGSVLTDLLDAMHILREKYGI
KSHCHCTNRQNLQGGNVPTMNGVSQVLQNVLHHSNKTSVSLPESQQQNSPQKSQTNGNSS
PGSASTDSRLTPPESQSPLHWLADLAEQKSREEKQENKEFTLEREIKEDGDQDASDSPNG
STSPPASQSNEQGSTLRDLLTTTAGKLRVGSTDAGIAFAPVYSMGTSSGKGGRTMPNILD
DIIASVVENKIPPNKTSKINIKSEPNEEPKESSLPATDESNKSYRDIPHSWICDQHILWL
KDYKNSNNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDSIV
SNANVKEFWDGFEEVSKRQKNKGGETVVLKLKDCPSGEDFKAMMPTRYEDFLRCLPLPEY
CNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVAAAKDHDIGTTNLHIEASDVVNVLVYVG
IAKGNGVLSKAGILKKFEEEELDDVLRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKIS
KEQGLEVLPEHDPIRDQSWYVNRKLRQRLLEEYGVRACTLIQFLGDAIVLPAGTLHQVQN
FHSCVQVTEDFVSPEHLVQSFHLTQELRLLKEEINYDDKLQVKNILYHAVKEMVRALKMH
EDEVEDMEDT
Download sequence
Identical sequences Q69ZK6
ENSMUSP00000133700 10090.ENSMUSP00000056227 ENSMUSP00000056227 NP_001229325.1.92730 XP_006513104.1.92730 XP_006513105.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]