SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6AW08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q6AW08
Domain Number - Region: 47-110
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6AW08
Sequence length 794
Comment (tr|Q6AW08|Q6AW08_CAEEL) Conserved Oligomeric Golgi (COG) Component {ECO:0000313|EMBL:CCD73514.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_Y71F9AM.4 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MEIDHMRTVELLAAKAATWGLPEAVEDAESDTEEDVVGLISGALKDIKKREKDLAELQFP
PEITAIRSNMKRFRDLQKQIDNSKATMNELREAYESVSSRTCSLHDACDRALAEQTSLST
GSQLIKTNLYYFKQADAIMKKLSVAKLMVTGHSFAAILVSIDECLTYLRAHPEYKESEAY
ISKFEQCLSRAMTWVRVAVLADLEACFNAVKDRQAQLELDYEKIGRAGQEEDTFALLYGV
FASKAAVVKASINVVEQRFSAVPEFEEMLAECQYAYFAKRNLLLGPILESTLANLSGTHD
DSTCRLTRDACTFMLRTCDDEYRLYRQFFVTRHTEERKLSTDGRISPAMSTITSVFTSAQ
SPQQVHPFETFSEQMCRTLYDMLRPRIVHNPHLETLAELCTMIKIEMIENRCSLQMVASI
LGDDASNDQNVSGLNPRAGFVSVMSELVGDIAERIVYRAGMYAQNDIAAYRPAAGDIAYP
QMLQMIRKIENEQKEQQEKEPEEGSAPATAIDQHCLWYPTVRRTVMCLSKIFPCLDIGVF
HSLARDMLFSCIDSLETASKAIMESPAPAKGWSKKLDAHLFVVKHLLILREQTAPYRQNV
LSFRSDSLNTKDFSIDFSKFTNVLFDSKSKWFELSTDNALLELITTVPIEMREQEGDSRR
VLDQQLRASTFRLAHEASLLMIRDLADWIEIAEDERMKEGFQLSGHPKLAAGVLKDVSAV
AYRNVGTKFTEIRAAYTLYIGVPETEEILLSPVRKRVIDIFTRVISFASKTYDAESLAIA
GLPNVQQLILLLNK
Download sequence
Identical sequences Q6AW08
NP_001021806.1.50509 Y71F9AM.4a Y71F9AM.4a 6239.Y71F9AM.4a Y71F9AM.4a.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]