SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6CDS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6CDS1
Domain Number 1 Region: 723-796
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.00085
Further Details:      
 
Domain Number 2 Region: 179-269
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 3 Region: 798-882
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 4 Region: 954-1055
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000394
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 1155-1214
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 6 Region: 873-961
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0052
Further Details:      
 
Domain Number 7 Region: 634-724
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 8 Region: 428-503
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000843
Family Eukaryotic type KH-domain (KH-domain type I) 0.0078
Further Details:      
 
Weak hits

Sequence:  Q6CDS1
Domain Number - Region: 351-401
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0089
Further Details:      
 
Domain Number - Region: 569-652
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0062
Further Details:      
 
Domain Number - Region: 487-536
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0922
Family Eukaryotic type KH-domain (KH-domain type I) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6CDS1
Sequence length 1215
Comment (tr|Q6CDS1|Q6CDS1_YARLI) YALI0B21662p {ECO:0000313|EMBL:CAG83444.1} KW=Complete proteome; Reference proteome OX=284591 OS=lipolytica). GN=YALI0_B21662g OC=Saccharomycetes; Saccharomycetales; Dipodascaceae; Yarrowia.
Sequence
MSDLSPAELLRQRHAAVSAAAEPTLTVSEGSLSKESSPVPEIAPAAPVKSVAGPSAASKR
KGLDINSLEAFPALNGGAAAPKAVWGKGGSAPAAPSPQSFGRAASTTISDVFTLKREEQQ
VGVRSELPKIIAKVKANTSTTIDSSTSKITGHTSFVIKGTPENVAKARRELHRALSQKIV
AKFEIPASVRAAVIGPRGSNLKPILEKSGAHIQIEKLESNGNNADDDEETVEVIVEGDSE
GIAIAKQEIFAIVSERVKNMTIRVRNVNYVLFPFLDKTAGDLTKGEDDVKLSIPDIFAPN
FTTAATITLSGDREATATVKERLERLAESLSTDLITSTESFPASKHKYISAKDVFAATSV
FITVPQAPNTSDDTVKFLGLPKDIKPAMNKVSEQVNSVKIDLLDISRAHGKSVPHAQALA
SYFKASGMLQKIADEYKVEIYIQQPDQLYAPGAQAVTIETSGPNEEAVKAARKAIVALVN
KYEPSKVSRVSDIDPFFLRNLAGPKDRNLAKYKKDHGVTVLVPENPKVNGDVILIYEGTS
EEDDFGPSADEIKATFAAVDSSFADIREKQAKIIGKLISVPVGEHKFVRGPDNTTLRAIV
GGTEGHEPFVRVTFGDEIKDAEEPVSADSIYVRGLKDEVTRVLKEIEEAVEDGKNYAVLS
QYTTEFQIPPEHVKHVVGKGGSQLAKFREYGVNIDLDESGQGVVKGIKKNADEAKVQILA
FAKKIADEVNVKLPVPADHHASLIGTGGKFVKRLEEKYDVRIRFPKTGEENANEIVLRGP
SKGVAKAKEEILDLVNYEIENSHSQTISVPVKSLPRIIGRGGEFINDIKDSTNTRIDVKQ
EKSDNTDETGNVDIEIVGTKAGVKEAAAKIQAIVSEFQDTVIEHIEVNPKFHGALIGPGG
QTLKDILTKAGMTDVTPSVAARTVAVPAAGTKDNKVRVQGSKKIVAKIVKIIQDMVAERE
SQISEVVDVPVSKHRDLIGAGGAAKRSLEEKFKVTLQIPKQGAKNKDGELDTGVSITGKA
EDVATAKAKIQELSQDKWKEEILVPRTLHTTVSDNGNLPRKLKYELKVNVDHGSVRTPRD
GNPVVPAGAIGSDSEDKDSFRWSVVEDAVDHAANGTIPWRLEGSDENVAKAKAIIEAALD
VALKHTQTGYLWLPDTSRYRFLVGPHGATVSHIREKSGCKIYIPKAGVADSAVTVRGSPE
GLEKAKEMMLAALKK
Download sequence
Identical sequences Q6CDS1
XP_501191.1.88470 gnl|GLV|YALI0B21662g 4952.Q6CDS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]