SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6CNG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6CNG5
Domain Number 1 Region: 278-320,353-434
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.79e-35
Family Eukaryotic type KH-domain (KH-domain type I) 0.00088
Further Details:      
 
Domain Number 2 Region: 184-276
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.43e-25
Family Cold shock DNA-binding domain-like 0.0000603
Further Details:      
 
Domain Number 3 Region: 131-183
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000000471
Family ECR1 N-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6CNG5
Sequence length 437
Comment (tr|Q6CNG5|Q6CNG5_KLULA) KLLA0E12739p {ECO:0000313|EMBL:CAG99611.1} KW=Complete proteome; Reference proteome OX=284590 OS=1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica). GN=KLLA0_E12739g OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
Sequence
MEQNSVLSLHQIKRCLTVDLCCNIFTSFTTLISSHLIALLFNLENFQLTNTKSNKGTARK
SAHRTPSAVPDIVISLLGTMSDVISVINRNEFWSNGRLEQDEYESDSSSGSEQEHDIEMS
GAHDSNGGIDHQDGSIVTPGELITDDPIWMKGHGTYFLENKTYSSVVGTVSRVNRLLSVL
PLKSRYIPETGDHIVGRITDVGNRRWKVDIGAKQYAVLMLGSVNLPGGVLRRKSETDELQ
MRNFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGTFVQVPSSLIVRSKNHTHNLP
GNVTIILGVNGFVWIRKSSKMDLSGKTTTTGSGQSDHLPGSNNAMSVSITRLEEESSWEI
YSDKNDTVTVSVRQTITRYANVIKALAHCELGITEPRIISAYEASMAYGNLGQLIESETM
ESLGQDVINSEKMRGAA
Download sequence
Identical sequences Q6CNG5
XP_454524.1.35115 28985.Q6CNG5 gnl|GLV|KLLA0E12739g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]