SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6DDT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6DDT5
Domain Number 1 Region: 403-494
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000829
Family N5-glutamine methyltransferase, HemK 0.04
Further Details:      
 
Domain Number 2 Region: 242-309
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000131
Family Glutathione S-transferase (GST), C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6DDT5
Sequence length 613
Comment (sp|Q6DDT5|GSTCD_XENLA) Glutathione S-transferase C-terminal domain-containing protein OX=8355 OS=Xenopus laevis (African clawed frog). GN=gstcd; OC=Xenopus.
Sequence
MEEQLYLDAEGPLLPLHTSISLFLMSYCDCKTWKIFLVLPDSKANNLSKNILLPRNLELE
TICKCDLPPLVRGCRLPAVVEASGAFCRAGLAVVLRHITHKAHIAEPSRNDIIELLGFKK
TCLKACAEVSQWTRLCEISIPRAIESFLKKPSATIPTEVLQFEKKLGEPVKVHNDDKIRR
QKLQQQMTANTNEAVDAKSNTAKTMPCFDIITNKTSLELGAALSKLTVQGALSRATREPS
HIRKAKNSDLPPLEHVFAEGLYFTLTDVVLLPCIHAFLVALSNVAEEKCSELPLIAAWYK
RVQQVPGVRFAASMCNITFLDILCENAKPQKMLSTFDSETEEKEIQDSNFVGGPRPTMTK
LKELGIEAIFSSHPCPSWAIDWESLPAAASPAEGKMSSERAVRKQQQLNNLLSVVTNIAK
PGDTIVDFCSGGGHVGIVLAHKLPSCQVILIENKEESLLRAKERCSELGLINIWFIQANL
DYFTGSFTIGVALHACGVATDMVMDHCIKARAAFAISPCCYGFIQNTVKTSFPRSCRFQE
ALNYKEHMILCRFADQTAVQLPAERRQIGKQCMGLVDLDRAWAAEQNKYKVQVITMEPES
CSPKNNMIVGSPI
Download sequence
Identical sequences Q6DDT5
NP_001086778.1.7800 gi|147904712|ref|NP_001086778| gi|50415219|gb|AAH77432| gi|82235763|sp|Q6DDT5|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]