SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6DEA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6DEA4
Domain Number 1 Region: 20-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.38e-34
Family PDI-like 0.003
Further Details:      
 
Domain Number 2 Region: 162-270
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.45e-33
Family PDI-like 0.005
Further Details:      
 
Domain Number 3 Region: 283-393
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000104
Family Thioltransferase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6DEA4
Sequence length 442
Comment (tr|Q6DEA4|Q6DEA4_XENLA) MGC79068 protein {ECO:0000313|EMBL:AAH77228.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=MGC79068 OC=Xenopus.
Sequence
MARAFLGAVACTLILAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQR
LTPDWKKAATALKGVVKVGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTA
DAIVDAALNSLRSFVKDRLGGRSGGSDSGRQSHSGGSGGSKKDVIELTDDTFDKNVLNSD
DVWLVEFFAPWCGHCKSLEPEWAAAATEVKEKTNGKVKLAAVDATVSQVLASRYGIRGFP
TIKIFQKGEEPVDYDGGRNRADIVARALDLFSENAPPPEINEILNGDIVKKTCDEHQLCI
VAVLPHILDTGAAGRNSYLEVMLKMAEKYKKKMWGWLWTEAGAQMDLETSLGIGGFGYPA
MAAINARKIKFALLKGSFSEQGINEFLRELSYGRGSTSPVGGGAIPKINTVEPWDGKDGE
LPAEDDIDLSDVELDDIGKDEL
Download sequence
Identical sequences Q6DEA4
gi|147906274|ref|NP_001086643| gi|50418205|gb|AAH77228| NP_001086643.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]