SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6DEV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6DEV0
Domain Number 1 Region: 328-434
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 202-322
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-24
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 3 Region: 608-662
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-17
Family Eukaryotic proteases 0.0021
Further Details:      
 
Domain Number 4 Region: 73-185
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000157
Family SEA domain 0.0099
Further Details:      
 
Domain Number 5 Region: 435-476
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 511-548
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 474-513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 551-590
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6DEV0
Sequence length 663
Comment (tr|Q6DEV0|Q6DEV0_XENTR) MGC89623 protein {ECO:0000313|EMBL:AAH76994.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=MGC89623 OC=Silurana.
Sequence
MKDSDSMMKYNNRPQSMNGFEEGVEFLPAANTKKVEKAGPKKKLAIFGVVIGAALLSLTI
GLLVWHFAYRNAPVQKLYTGYLRIANTQFVEAYENSTTREFADLSVKVISTLRTLYNGEK
DIAPYLQQCSISAFSEGSDNNVVGYYWSEFSVPAFREEAFEKAISELKLPTVNLRQRAFA
VDSLVAYPTDPQIARNFKNSSCAFFLHSSAGVMTKFSSPGFPDTPYPPNARCLWTLRADA
GQMIRLKFKTFKMEKCKANAGDFVMVYDSLSPIEPRAQIRLCGIYPPSYNLTFFSSSNVM
LVTLVTDNVGKFPGFLAEFSQFPKTSLCGGYIRDASGVFTSPYFPGHYPPKIECIWDIQV
PDNKFVKLRFNMFYLAEPGVPVTKCTKDFVEINGQKYCGERKFFVVSNNSSKMSVRFVSD
QSYTDTGFTAEYLSYEPRNPCPDQFACKSGRCIRLDQKCDGWNDCEDFSDEKSCTCTALQ
FRCTNSKLCKPSYFVCDGVNDCGDSSDELACQCPNNTYKCGNGKCIPESQKCDRTDNCGD
GSDEAECGRVLTTTCTEYTYKCKNNQCITKKNPECDGENDCSDGSDEISAKCNCGKRPFT
KKSRIVGGVNADSGGPLSSVELNNKVYLAGIVSWGEGCARRNKPGVYTRVAMMRDWIRDK
TGL
Download sequence
Identical sequences Q6DEV0
gi|49900216|gb|AAH76994| gi|52346064|ref|NP_001005075| NP_001005075.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]