SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6DF55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6DF55
Domain Number 1 Region: 23-312
Classification Level Classification E-value
Superfamily L domain-like 5.36e-54
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 406-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000102
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6DF55
Sequence length 661
Comment (sp|Q6DF55|VASN_XENTR) Vasorin KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=vasn; OC=Silurana.
Sequence
MWHLLVWIILLATAQQMITEGCPAGCQCNTPQTVFCLARKNSNFPRSVPPDTLNLYVFEN
GISSIEESSFIGLNGLHLLDLSHNQLSSLPGGVFRNLANLSNLDLTSNQLTEISADTFQG
LSRLERLYLNGNRIRSIHPEAFKGIESLLELKLSNNQLVTPPAFSLPHLLLLDLSYNAIP
VIQQGVFNAGNIESLRLAGLGLKEVPEELLSGLKNLHELDLSDNQLDKVPPGLHGLTKLN
IAGNVGFSQIQVDDLSNLPALQELDLSGLSLQTLPKGLFRSSKRLRAVSLAQNPFNCVCS
LGWLSEWMRVSGVVLLRPDETRCHFPPKNAGKTLRQLRDSEYGCPAPTTIQMPSTMPPST
TTGPPTTTKHLQTEAPTTASTTTTTIPHQEQEEDTQPFQFDFEDTLCPPQTCLNGGSCHL
DPTGQLECECPPGFQGTYCETGPVTPAVVTEMYIEQVKIIEVTVSSIRVDLQSYSQNKEK
LRAIRLTVRNLYGADRRPMIYKLPPTLPEYTVRALSSNSSYWVCLGSQGEGGPEEDLCTE
THTLGEPPKHSPQVTQSQEGNLTLVLVPAVAAGILLSAAVAAAACYARRRKGKGHSVEDG
GPLEMDGVKKGLDGKGEVKKLSEDPTGPEKTGAESEEPLMDSTRIGNNNDAPTGRLPHSY
F
Download sequence
Identical sequences Q6DF55
NP_001005036.1.99540 gi|49899857|gb|AAH76888| gi|52345978|ref|NP_001005036| gi|82182797|sp|Q6DF55| 8364.ENSXETP00000037686 ENSXETP00000037686 ENSXETP00000037686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]