SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6DF81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6DF81
Domain Number 1 Region: 274-386
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.09e-32
Family PDI-like 0.0078
Further Details:      
 
Domain Number 2 Region: 394-507
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.35e-30
Family PDI-like 0.0043
Further Details:      
 
Domain Number 3 Region: 156-267
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.15e-23
Family PDI-like 0.016
Further Details:      
 
Domain Number 4 Region: 40-143
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000264
Family PDI-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6DF81
Sequence length 523
Comment (tr|Q6DF81|Q6DF81_XENLA) MGC84594 protein {ECO:0000313|EMBL:AAH76861.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=MGC84594 OC=Xenopus.
Sequence
MAPAGRFSGRKIMLSLLLLIICPSCLLSIKVSPLIERTSDHKDFKKLLRTRNNVLVLYSK
SASAAEQQLKLLSNIAQDVKGTATVSWIDCGDGESRKLCKKLKVDPSKKPNGLELLHYKD
GTFHTEYNRPNTYKSLVAFLRDPEGAPLWEENPEAKDVVHIDNEKDFRKLLKKEDRPLLM
MLYAPWCGVCKRLIPSYQQAATNLKGSYVLAGMNIHPPEFDRLKEEYNVKGYPTVLYFEK
GKYMFNFEKYGASANDISDWLKNPQPPTPEAPEVAWADQDNAVYHLTDADFDQFLSEHPS
VLVMFYAPWCGHCKKMKPDYEKAAVTLQQSGVGVLAAVDSTVHRAVSEKFHVTGFPTVKY
FENGEEKYTVPHLRTEQKIVEWMNNPEAPPPPEPSWDEKPSTVLHLVGEEFREALKKKKH
SLVMFYAPWCPHCKSSVPDFTTAADTFKDDRKIAYGAVDCTKEKNQGVCKQEGVEGFPTF
NYYNYGKFSEKYSGERTESGFIGFIKTLRERDQVKLGKKKDEL
Download sequence
Identical sequences Q6DF81
NP_001086600.1.7800 gi|148228797|ref|NP_001086600| gi|49899130|gb|AAH76861|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]