SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6DFQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6DFQ0
Domain Number 1 Region: 25-516
Classification Level Classification E-value
Superfamily Sema domain 1.31e-172
Family Sema domain 0.000000000182
Further Details:      
 
Domain Number 2 Region: 512-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000349
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 580-657
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000506
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6DFQ0
Sequence length 695
Comment (tr|Q6DFQ0|Q6DFQ0_XENTR) Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (Semaphorin) 3F {ECO:0000313|EMBL:AAH76684.1} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=sema3f OC=Silurana.
Sequence
MLVSALPPLLLLLLNLPPCVRTTRPPRVYLSYRDLMESRSARSFTFGFNTSDYRILLLDQ
DQDRMYVGSRDYVLSLDLGNINREPLIIHWPAPLNRHKECLMAGRGRVDECYNYLRVIQP
LNRTHLYACGTGAYQPQCAVIYRGWRSEDYVFRIVPASLESGKGRCPYDPKQENMATLID
GVLYAGVQVDYMGTDSAIFRTMGHKPPIRTEQYDSRWLNDPLFVGSLVVSESSFKEDDKL
YILFRERSLEGENGPALVSRIARVCLNDEGGLRSLVGKWTSYLKARLVCSVIGQDGVETS
FDQLRDVFIQPTHDKQNPLIYGVFTTLGSVFRGSAVCVYSLADVRAVFNGPFAHKEGHGY
QMTAYSGKTPYPRPGACAGGFSVPRNRSSRNFGEDVLRFVRTHPLMYSSVYPVNRRPLLL
LSDASYTYTSIAVDRVPAADGEYTVLFLGTDRGTVQKVMILPRGTKETESITLEEVEVFK
VPSPIRNLRISSKRHQLYVSSDVGVTQLSLHRCGRYGDSCADCCLARDPYCAWDGKGCVR
YTPSPSRRSRRQDVKHGDPLRQCRGYNTQVDRGIAERLQISVEGGSAYLQCDTHSPLESV
TWLLQRDGSQHRREVRLSAIDGGAVLRSVQASDAGVYTCTGTENGFRRSRAKIRLNVLPR
DLLEKLTAAPTLAPMAAQCPPPRRPRPRPSHTDRN
Download sequence
Identical sequences Q6DFQ0
NP_001006924.1.99540 XP_012823713.1.99540 gi|49903346|gb|AAH76684| gi|55742366|ref|NP_001006924| ENSXETP00000049036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]