SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6DSU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6DSU3
Domain Number 1 Region: 34-506
Classification Level Classification E-value
Superfamily Sema domain 2.09e-94
Family Sema domain 0.00086
Further Details:      
 
Domain Number 2 Region: 1367-1490,1656-1839
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-34
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 845-937
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000478
Family Other IPT/TIG domains 0.07
Further Details:      
 
Domain Number 4 Region: 935-1027
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000607
Family Other IPT/TIG domains 0.084
Further Details:      
 
Domain Number 5 Region: 509-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000458
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1026-1103
Classification Level Classification E-value
Superfamily E set domains 0.00000000168
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6DSU3
Sequence length 1880
Comment (tr|Q6DSU3|Q6DSU3_DANRE) Plexin D1 {ECO:0000313|EMBL:AAT64905.1} OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=plxnd1 OC=Cyprinidae; Danio.
Sequence
MPPSAADRRSALALLSALLLAALQTRSAGALHVQQAFATPGRTNNFALDAASGRVYLAAV
NNLYQLNATLALEVEMRTGPVLDNPLCHAPQLPQATCEHQKTLTDNHNKLLALDRAQDVL
LACGSVYQGFCELRRLENVSRLAVQFPQDGATVFPSMLNIAANHENASTVGLVFRTHGGS
PRLLVGATYTGMGTEYFPKNHSKEDLRFENTPEIAIRALDTRELGRLFTYDINPSEDNVF
KIKQEVKQKNKLSFVHAFALGNYSYIAFNNDANSGLKESQPNSVLARICLDTDAPRRAAE
SRKLTESYAQMGLRCGTYTRLLSVSPAELRAETFLFAVFGRADGRAAVCVFRVAEVEEMI
RQGRRNCSHGPNSDVQVLDSVIQGSGAECEGKGSIMLQLQTDQLNCGAAHLQHPLALRRP
LRARPLYEAQGLSSVAVDSAHNHTLMFLGSRGRLHKVSLHSNFSVSQQWSLRLPANEPVH
HIMTFDPSDRTYLYVMTSHHLLRVRVSSCEQYSSCGDCLSAGDPHCGWCTLERRCSVQQD
CSSVSLSRSWISISEGVQQCPSMTITPAEISRSAEMRDVGILVAGSVPDLQGLRVECDYG
MGISTNATVHLDYGTSHIQTCPLPPAHTLPTIPSGTDHVTVPVSINANGVSVVSGRFIIY
DCERTGQIHSTTACTSCLSSAWRCFWDPQLHQCVSSKNNTQQLLQNSSSCPSMVAYEVPP
LPTGSSPVFSLELKNVEHGTALECVYSDGQQYRAQWLDGPWVNCSGATLKTTQWSESFSL
NLRRAGDATYIDNPQRMTVEVYSCSAGVSDCSQCLGRAALGQECVWCEHICRQQDQCPTT
SSARCPAPLIHKIEPLSGPLTGGTLLTVTGKNLGHRADQLSVSIGGVTCHTLPQQYTVSI
RLVCETDASLEQMSGQVTVGVAGDAVGVSKEQFSFVEPRLLRFSPAQGPLAGGTTLTIQG
QFLDAGSTTDIQINNTHTCSIRTRSSEIIRCVMPAAASAENVSVCVVFDGRPCVSASPNF
TFSYQKNPTISHIWPSRSYISGGRSISVSGVGFDLVQSVVMEVPGVGQTNCSCVSSTLIL
CQSPAADQAQQTAVLFSLNGVQYRDAASAGLEEGEQPHTQRYSFQYVEDPQFYTANKEKL
IKHHPGEPLILIINKGPSDLDLTLDEYSVTIGSDLCDITFHNQQLFHCSINRSLSASTGE
LPVTVRVGHFQKVIAMVQMGGGSELAIVVSIVVCCVLLLLCTVALVVYCTKSRRAERYWQ
KTLVQMEEMESQIRDEIRKGFAELQTDMTDLTKELSRTQGIPFLEYKQFVTRTFFPKMCC
DYERRLVQPVYENDPLGPRAHSETHPLLQDWQPAGSVRPNLEEGITLFSTLLNNKHFLVT
FVHALEQQRDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASATKNPKLMLRR
TESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGSIDVLTGKARYTLNEEW
LLRENIEAKPQNVMVSFQGLGMDSVCVRVMNSDTICQVKEKILEAFYKNLPYSQWPREED
VELEWFPEGRSSRILQDLDDSSVMEDGRKKLNTVFHYQIPDGASLAMSLKDKRENTLGRV
KDLDTEKYVHLVLPHDELMESRKTHRQSQRKKVLPEIYLTRLLSTKGTLQKFLDDLFQAI
LSVPAENPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDI
EKTDHMDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYKKRVQSFYRQIQEL
PALSEQEMNTHLAEESRKHRNEFNTTLALTEVYKYAKRYRAQVASALDSNPTARRTQLQH
KFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences Q6DSU3
NP_991260.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]